General Information

  • ID:  hor006410
  • Uniprot ID:  P22890
  • Protein name:  Glucagon
  • Gene name:  GCG
  • Organism:  Octodon degus (Degu) (Sciurus degus)
  • Family:  Glucagon family
  • Source:  Animal
  • Expression:  Glucagon release is stimulated by hypoglycemia and inhibited by hyperglycemia, insulin, and somatostatin. GLP-1 and GLP-2 are induced in response to nutrient ingestion (By similarity). |Glucagon is secreted in the A cells of the islets of Langerhans. GLP-
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Octodon (genus), Octodontidae (family), Hystricomorpha (suborder), Rodentia (order), Glires , Euarchontoglires (superorder), Boreoeutheria , Eutheria , Theria , Mammalia (class), Amniota , Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction; GO:0014823 response to activity; GO:0042593 glucose homeostasis; GO:0050796 regulation of insulin secretion; GO:0050896 response to stimulus
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  HSQGTFTSDYSKFLDTRRAQDFLDWLKNT
  • Length:  29(53-81)
  • Propeptide:  MKSIYFVAGLFVMLVQGSWQHPLQDTEEKPRSFSTSQTDLLDDPDQMNEDKRHSQGTFTSDYSKFLDTRRAQDFLDWLKNTKRNRNEIAKRHDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRGRRDFPEEVTIVEELRRRHADGSFSDEMNTVLDHLATKDFINWLIQTKITDRK
  • Signal peptide:  MKSIYFVAGLFVMLVQGSWQ
  • Modification:  T2 Phosphoserine
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  [Glucagon]: Plays a key role in glucose metabolism and homeostasis. Regulates blood glucose by increasing gluconeogenesis and decreasing glycolysis. A counterregulatory hormone of insulin, raises plasma glucose levels in response to insulin-induced hypogl
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P22890-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor006410_AF2.pdbhor006410_ESM.pdb

Physical Information

Mass: 397839 Formula: C155H229N43O49
Absent amino acids: CEIMPV Common amino acids: DT
pI: 7.54 Basic residues: 5
Polar residues: 10 Hydrophobic residues: 8
Hydrophobicity: -105.86 Boman Index: -9004
Half-Life / Aliphatic Index: 3.5 hour Aliphatic Index: 43.79
Instability Index: 3463.45 Extinction Coefficient cystines: 6990
Absorbance 280nm: 249.64

Literature

  • PubMed ID:  2293024
  • Title:  Cloning of complementary DNAs encoding islet amyloid polypeptide, insulin, and glucagon precursors from a New World rodent, the degu, Octodon degus.
  • PubMed ID:  12554744
  • Title:  Glucagon-like peptides: regulators of cell proliferation, differentiation, and apoptosis.
  • PubMed ID:  12626323
  • Title:  Glucagon and r
  • PubMed ID:  10322410
  • Title:  
  • PubMed ID:  10605628
  • Title: